PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29739.m003586
Common NameLOC8258551, RCOM_0706470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 159aa    MW: 18034.9 Da    PI: 6.358
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29739.m003586genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.31.2e-3198156159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDg++WrKYG+K+vk+s++pr+YYrC+ +gCpvkk+ver+++d ++v++tYeg Hnh+
  29739.m003586  98 LDDGFKWRKYGKKMVKNSPNPRNYYRCSVEGCPVKKRVERDKDDLRFVITTYEGIHNHP 156
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-3384157IPR003657WRKY domain
SuperFamilySSF1182904.71E-2891156IPR003657WRKY domain
PROSITE profilePS5081130.69993158IPR003657WRKY domain
SMARTSM007741.5E-3698157IPR003657WRKY domain
PfamPF031065.8E-2599156IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MSHYSAGSQE SDYGDPTNFE LSEFLMFDEW IEDANDQSSL LSGSIQNPVY RAHVVGESGG  60
AISPYGEHSN GEGREGSREK KGVKERVAFK TKSEIEILDD GFKWRKYGKK MVKNSPNPRN  120
YYRCSVEGCP VKKRVERDKD DLRFVITTYE GIHNHPSSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-2586155271WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8275972e-64KT827597.1 Manihot esculenta WRKY transcription factor 22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516104.11e-117PREDICTED: probable WRKY transcription factor 50 isoform X2
SwissprotQ8VWQ52e-44WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLB9RQT51e-116B9RQT5_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0006s24050.12e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.18e-44WRKY DNA-binding protein 50